Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3409732..3410352 | Replicon | chromosome |
Accession | NZ_CP104677 | ||
Organism | Salmonella enterica strain PNUSAS036471 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | N4534_RS16765 | Protein ID | WP_001280991.1 |
Coordinates | 3410134..3410352 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | N4534_RS16760 | Protein ID | WP_000344807.1 |
Coordinates | 3409732..3410106 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4534_RS16750 (3404871) | 3404871..3406064 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N4534_RS16755 (3406087) | 3406087..3409236 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
N4534_RS16760 (3409732) | 3409732..3410106 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
N4534_RS16765 (3410134) | 3410134..3410352 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
N4534_RS16770 (3410531) | 3410531..3411082 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
N4534_RS16775 (3411199) | 3411199..3411669 | + | 471 | WP_000136181.1 | YlaC family protein | - |
N4534_RS16780 (3411725) | 3411725..3411865 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
N4534_RS16785 (3411871) | 3411871..3412131 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
N4534_RS16790 (3412356) | 3412356..3413906 | + | 1551 | WP_000213138.1 | EAL domain-containing protein | - |
N4534_RS16800 (3414137) | 3414137..3414526 | + | 390 | WP_000961287.1 | MGMT family protein | - |
N4534_RS16805 (3414559) | 3414559..3415128 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T258953 WP_001280991.1 NZ_CP104677:3410134-3410352 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT258953 WP_000344807.1 NZ_CP104677:3409732-3410106 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|