Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 809911..810536 | Replicon | chromosome |
| Accession | NZ_CP104677 | ||
| Organism | Salmonella enterica strain PNUSAS036471 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N4534_RS03935 | Protein ID | WP_000911337.1 |
| Coordinates | 810138..810536 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | C0PXM4 |
| Locus tag | N4534_RS03930 | Protein ID | WP_000557545.1 |
| Coordinates | 809911..810138 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4534_RS03900 (804956) | 804956..806473 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| N4534_RS03905 (806549) | 806549..807094 | - | 546 | WP_000133986.1 | isopentenyl-diphosphate Delta-isomerase | - |
| N4534_RS03910 (807359) | 807359..808117 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
| N4534_RS03920 (808402) | 808402..809208 | - | 807 | WP_079848076.1 | DUF1460 domain-containing protein | - |
| N4534_RS03925 (809483) | 809483..809734 | - | 252 | WP_001540858.1 | hypothetical protein | - |
| N4534_RS03930 (809911) | 809911..810138 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| N4534_RS03935 (810138) | 810138..810536 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| N4534_RS03940 (811343) | 811343..811879 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
| N4534_RS03945 (811926) | 811926..812558 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| N4534_RS03950 (813277) | 813277..813858 | + | 582 | WP_001244652.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 809483..818330 | 8847 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T258947 WP_000911337.1 NZ_CP104677:810138-810536 [Salmonella enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|