258944

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/Xre(antitoxin)
Location 6836..7337 Replicon plasmid unnamed3
Accession NZ_CP104668
Organism Escherichia coli strain 2021CK-00607

Toxin (Protein)


Gene name TsxA Uniprot ID A0A8T3LE03
Locus tag N5914_RS26060 Protein ID WP_000702243.1
Coordinates 6836..7096 (+) Length 87 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag N5914_RS26065 Protein ID WP_001132407.1
Coordinates 7086..7337 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5914_RS26015 (N5914_26025) 2375..2527 + 153 Protein_1 FlmC family protein -
N5914_RS26020 (N5914_26030) 2475..2594 + 120 WP_229002406.1 Hok/Gef family protein -
N5914_RS26025 (N5914_26035) 2744..3340 + 597 WP_000125165.1 ProQ/FINO family protein -
N5914_RS26030 (N5914_26040) 3358..3642 - 285 WP_001162371.1 hypothetical protein -
N5914_RS26035 (N5914_26045) 3716..4381 - 666 WP_000532148.1 division plane positioning ATPase MipZ -
N5914_RS26040 (N5914_26050) 4979..5308 + 330 WP_261629120.1 hypothetical protein -
N5914_RS26045 (N5914_26055) 5889..6212 + 324 WP_000427402.1 hypothetical protein -
N5914_RS26050 (N5914_26060) 6253..6462 + 210 WP_000866037.1 hypothetical protein -
N5914_RS26055 (N5914_26065) 6560..6784 + 225 WP_000814383.1 hypothetical protein -
N5914_RS26060 (N5914_26070) 6836..7096 + 261 WP_000702243.1 hypothetical protein Toxin
N5914_RS26065 (N5914_26075) 7086..7337 + 252 WP_001132407.1 transcriptional regulator Antitoxin
N5914_RS26070 (N5914_26080) 7887..8165 + 279 WP_000545937.1 hypothetical protein -
N5914_RS26075 (N5914_26085) 8585..8851 + 267 WP_000680170.1 type II toxin-antitoxin system HicB family antitoxin -
N5914_RS26080 (N5914_26090) 8958..9401 - 444 WP_089565173.1 hypothetical protein -
N5914_RS26085 (N5914_26095) 9699..9881 + 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
N5914_RS26090 (N5914_26100) 9906..10343 + 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
N5914_RS26095 (N5914_26105) 10474..10794 - 321 WP_001401701.1 hypothetical protein -
N5914_RS26100 (N5914_26110) 11128..11306 - 179 Protein_18 hypothetical protein -
N5914_RS26105 (N5914_26115) 11308..11511 - 204 WP_000224735.1 hypothetical protein -
N5914_RS26110 (N5914_26120) 11805..11966 - 162 Protein_20 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..58872 58872


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-37)


Sequences

Toxin        


Download         Length: 87 a.a.        Molecular weight: 9788.21 Da        Isoelectric Point: 9.5163

>T258944 WP_000702243.1 NZ_CP104668:6836-7096 [Escherichia coli]
MKIRKGDRQYYLNKEGDAFHLVKRVKTFSKSATLGKTKATVKTVADLVFHEEAFDTIDFASDGLRENDKEIVSMMIQEMS
EGKNAK

Download         Length: 261 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9404.77 Da        Isoelectric Point: 9.8120

>AT258944 WP_001132407.1 NZ_CP104668:7086-7337 [Escherichia coli]
MPNENTPENIKRLRQKIGLTQKECAEIFSMSPRTWRRKEEPVGTASGTALTPVEFKFLLLLAGEHPDYVLCKRNKKNSDS
GSN

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References