Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 83155..83799 | Replicon | plasmid unnamed2 |
Accession | NZ_CP104667 | ||
Organism | Escherichia coli strain 2021CK-00607 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A1C0Y1A0 |
Locus tag | N5914_RS25955 | Protein ID | WP_029701816.1 |
Coordinates | 83155..83337 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A1M2I339 |
Locus tag | N5914_RS25960 | Protein ID | WP_072770518.1 |
Coordinates | 83368..83799 (+) | Length | 144 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5914_RS25935 (N5914_25945) | 78426..78650 | - | 225 | WP_021551764.1 | host cell division inhibitor Icd-like protein | - |
N5914_RS25940 (N5914_25950) | 79066..80025 | - | 960 | WP_124062617.1 | lytic replication protein | - |
N5914_RS25945 (N5914_25955) | 80225..81223 | - | 999 | WP_021551762.1 | hypothetical protein | - |
N5914_RS25950 (N5914_25960) | 81237..82922 | - | 1686 | WP_068862842.1 | portal protein | - |
N5914_RS25955 (N5914_25965) | 83155..83337 | + | 183 | WP_029701816.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N5914_RS25960 (N5914_25970) | 83368..83799 | + | 432 | WP_072770518.1 | hypothetical protein | Antitoxin |
N5914_RS25965 (N5914_25975) | 83912..85297 | - | 1386 | WP_029701814.1 | hypothetical protein | - |
N5914_RS25970 (N5914_25980) | 85389..85757 | - | 369 | WP_029701812.1 | hypothetical protein | - |
N5914_RS25975 (N5914_25985) | 85754..87706 | - | 1953 | WP_062876065.1 | hypothetical protein | - |
N5914_RS25980 (N5914_25990) | 87703..88320 | - | 618 | WP_021551755.1 | hypothetical protein | - |
N5914_RS25985 (N5914_25995) | 88310..88756 | - | 447 | WP_016262345.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..91750 | 91750 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6850.97 Da Isoelectric Point: 10.9041
>T258943 WP_029701816.1 NZ_CP104667:83155-83337 [Escherichia coli]
VKYSEFKRWLIQQGAEFRKAPGGGSHQKVNLNGKRSVFPDHGSKEMPEPLRKKIMKDLGL
VKYSEFKRWLIQQGAEFRKAPGGGSHQKVNLNGKRSVFPDHGSKEMPEPLRKKIMKDLGL
Download Length: 183 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 15627.95 Da Isoelectric Point: 5.2844
>AT258943 WP_072770518.1 NZ_CP104667:83368-83799 [Escherichia coli]
MFNYPVKLERDDKTGAYVVSCRDLPLFNSVGDSVEEALLEAGYGLVAAVAIEIEERRPVPTGSEPKEGEYVVSLPVLPAM
KAALHNAMIETGTRKAELARKLGKNGTQIDRLLDVEHSSKVETVELALHQLNKNIAVSVTPMR
MFNYPVKLERDDKTGAYVVSCRDLPLFNSVGDSVEEALLEAGYGLVAAVAIEIEERRPVPTGSEPKEGEYVVSLPVLPAM
KAALHNAMIETGTRKAELARKLGKNGTQIDRLLDVEHSSKVETVELALHQLNKNIAVSVTPMR
Download Length: 432 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1C0Y1A0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M2I339 |