Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 52543..53144 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP104667 | ||
| Organism | Escherichia coli strain 2021CK-00607 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | N5914_RS25795 | Protein ID | WP_175107129.1 |
| Coordinates | 52764..53144 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | N5914_RS25790 | Protein ID | WP_001190712.1 |
| Coordinates | 52543..52764 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5914_RS25740 (N5914_25750) | 48355..48756 | + | 402 | WP_048666477.1 | hypothetical protein | - |
| N5914_RS25745 (N5914_25755) | 48769..49062 | + | 294 | WP_032152846.1 | hypothetical protein | - |
| N5914_RS25750 (N5914_25760) | 49062..49238 | + | 177 | WP_157924453.1 | hypothetical protein | - |
| N5914_RS25755 (N5914_25765) | 49318..49527 | + | 210 | WP_064198801.1 | hypothetical protein | - |
| N5914_RS25760 (N5914_25770) | 49524..50321 | + | 798 | WP_065311616.1 | hypothetical protein | - |
| N5914_RS25765 (N5914_25775) | 50378..50728 | - | 351 | WP_261629109.1 | hypothetical protein | - |
| N5914_RS25770 (N5914_25780) | 50761..51012 | + | 252 | WP_001283837.1 | DNA polymerase III subunit theta | - |
| N5914_RS25775 (N5914_25785) | 51038..51388 | + | 351 | WP_016262416.1 | hypothetical protein | - |
| N5914_RS25780 (N5914_25790) | 51488..51877 | + | 390 | WP_068862856.1 | S24 family peptidase | - |
| N5914_RS25785 (N5914_25795) | 52012..52434 | + | 423 | WP_016262418.1 | hypothetical protein | - |
| N5914_RS25790 (N5914_25800) | 52543..52764 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N5914_RS25795 (N5914_25805) | 52764..53144 | + | 381 | WP_175107129.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| N5914_RS25800 (N5914_25810) | 53180..54280 | - | 1101 | WP_261629110.1 | hypothetical protein | - |
| N5914_RS25805 (N5914_25815) | 54267..55073 | - | 807 | WP_261629111.1 | hypothetical protein | - |
| N5914_RS25810 (N5914_25820) | 55080..55730 | - | 651 | WP_021551780.1 | DUF2829 domain-containing protein | - |
| N5914_RS25815 (N5914_25825) | 55745..56239 | - | 495 | WP_097430097.1 | dUTP diphosphatase | - |
| N5914_RS25820 (N5914_25830) | 56236..56724 | - | 489 | WP_016262423.1 | hypothetical protein | - |
| N5914_RS25825 (N5914_25835) | 56721..57065 | - | 345 | WP_016262424.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..91750 | 91750 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13706.60 Da Isoelectric Point: 5.6406
>T258942 WP_175107129.1 NZ_CP104667:52764-53144 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVVYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELYGSNI
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVVYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGIQVYDSPVLVELAVGAATGEIPVSSVAEKLRELYGSNI
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|