Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 55752..56377 | Replicon | plasmid unnamed1 |
Accession | NZ_CP104666 | ||
Organism | Escherichia coli strain 2021CK-00607 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1D7QA53 |
Locus tag | N5914_RS24985 | Protein ID | WP_039023147.1 |
Coordinates | 55979..56377 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1D7QA08 |
Locus tag | N5914_RS24980 | Protein ID | WP_039023146.1 |
Coordinates | 55752..55979 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5914_RS24980 (55752) | 55752..55979 | + | 228 | WP_039023146.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
N5914_RS24985 (55979) | 55979..56377 | + | 399 | WP_039023147.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N5914_RS24990 (56386) | 56386..58557 | - | 2172 | WP_121350052.1 | type IV conjugative transfer system coupling protein TraD | - |
N5914_RS24995 (58810) | 58810..59541 | - | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
N5914_RS25000 (59573) | 59573..60070 | - | 498 | WP_000605862.1 | entry exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1B / erm(B) / dfrA12 / aadA2 / qacE / sul1 / blaNDM-5 / mph(A) / aadA5 / tet(B) | - | 1..131846 | 131846 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14885.26 Da Isoelectric Point: 8.2824
>T258940 WP_039023147.1 NZ_CP104666:55979-56377 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAAIHT
GQIRAELARQGRPVGPFDQMIAGHARCRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAAIHT
GQIRAELARQGRPVGPFDQMIAGHARCRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7QA53 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7QA08 |