Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4499331..4499926 | Replicon | chromosome |
Accession | NZ_CP104665 | ||
Organism | Escherichia coli strain 2021CK-00607 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | V0SXT4 |
Locus tag | N5914_RS21680 | Protein ID | WP_000239581.1 |
Coordinates | 4499331..4499681 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | N5914_RS21685 | Protein ID | WP_001223213.1 |
Coordinates | 4499675..4499926 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5914_RS21660 (4494384) | 4494384..4495886 | - | 1503 | WP_022646474.1 | sugar ABC transporter ATP-binding protein | - |
N5914_RS21665 (4496093) | 4496093..4497439 | + | 1347 | WP_000483767.1 | IS4-like element IS4 family transposase | - |
N5914_RS21670 (4497456) | 4497456..4498412 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
N5914_RS21675 (4498722) | 4498722..4499252 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
N5914_RS21680 (4499331) | 4499331..4499681 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
N5914_RS21685 (4499675) | 4499675..4499926 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
N5914_RS21690 (4500138) | 4500138..4500479 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
N5914_RS21695 (4500482) | 4500482..4504261 | - | 3780 | WP_022646473.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 4496111..4497439 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T258933 WP_000239581.1 NZ_CP104665:c4499681-4499331 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|