Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4198097..4198647 Replicon chromosome
Accession NZ_CP104665
Organism Escherichia coli strain 2021CK-00607

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag N5914_RS20230 Protein ID WP_001160966.1
Coordinates 4198097..4198411 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag N5914_RS20235 Protein ID WP_000125568.1
Coordinates 4198414..4198647 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5914_RS20205 (4193772) 4193772..4195058 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
N5914_RS20210 (4195058) 4195058..4196047 + 990 WP_000241224.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
N5914_RS20215 (4196044) 4196044..4196865 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
N5914_RS20220 (4196868) 4196868..4197245 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
N5914_RS20225 (4197252) 4197252..4198100 + 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
N5914_RS20230 (4198097) 4198097..4198411 - 315 WP_001160966.1 CcdB family protein Toxin
N5914_RS20235 (4198414) 4198414..4198647 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
N5914_RS20240 (4198733) 4198733..4199212 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
N5914_RS20245 (4199404) 4199404..4201266 - 1863 WP_022645165.1 glutathione-regulated potassium-efflux system protein KefC -
N5914_RS20250 (4201259) 4201259..4201789 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
N5914_RS20255 (4201897) 4201897..4203228 - 1332 WP_001183201.1 MFS transporter -
N5914_RS20260 (4203286) 4203286..4203573 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T258927 WP_001160966.1 NZ_CP104665:c4198411-4198097 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT258927 WP_000125568.1 NZ_CP104665:c4198647-4198414 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References