Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3775136..3775754 | Replicon | chromosome |
Accession | NZ_CP104665 | ||
Organism | Escherichia coli strain 2021CK-00607 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N5914_RS18235 | Protein ID | WP_001291435.1 |
Coordinates | 3775536..3775754 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N5914_RS18230 | Protein ID | WP_000344800.1 |
Coordinates | 3775136..3775510 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5914_RS18220 (3770225) | 3770225..3771418 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N5914_RS18225 (3771441) | 3771441..3774590 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
N5914_RS18230 (3775136) | 3775136..3775510 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N5914_RS18235 (3775536) | 3775536..3775754 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N5914_RS18240 (3775926) | 3775926..3776477 | + | 552 | WP_000102574.1 | maltose O-acetyltransferase | - |
N5914_RS18245 (3776593) | 3776593..3777063 | + | 471 | WP_022645280.1 | YlaC family protein | - |
N5914_RS18250 (3777227) | 3777227..3778777 | + | 1551 | WP_022645279.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N5914_RS18255 (3778819) | 3778819..3779172 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
N5914_RS18265 (3779551) | 3779551..3779862 | + | 312 | WP_000409911.1 | MGMT family protein | - |
N5914_RS18270 (3779893) | 3779893..3780465 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T258925 WP_001291435.1 NZ_CP104665:3775536-3775754 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT258925 WP_000344800.1 NZ_CP104665:3775136-3775510 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |