Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3029949..3030733 | Replicon | chromosome |
Accession | NZ_CP104665 | ||
Organism | Escherichia coli strain 2021CK-00607 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | N5914_RS14530 | Protein ID | WP_000613626.1 |
Coordinates | 3030239..3030733 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A0A1AEM7 |
Locus tag | N5914_RS14525 | Protein ID | WP_024946541.1 |
Coordinates | 3029949..3030242 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5914_RS14515 (3025110) | 3025110..3026069 | - | 960 | WP_022645527.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
N5914_RS14520 (3026642) | 3026642..3029815 | + | 3174 | WP_022645526.1 | ribonuclease E | - |
N5914_RS14525 (3029949) | 3029949..3030242 | + | 294 | WP_024946541.1 | DUF1778 domain-containing protein | Antitoxin |
N5914_RS14530 (3030239) | 3030239..3030733 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
N5914_RS14535 (3030828) | 3030828..3031781 | - | 954 | WP_022645524.1 | flagellar hook-associated protein FlgL | - |
N5914_RS14540 (3031793) | 3031793..3033436 | - | 1644 | WP_022645523.1 | flagellar hook-associated protein FlgK | - |
N5914_RS14545 (3033502) | 3033502..3034443 | - | 942 | WP_001317765.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
N5914_RS14550 (3034443) | 3034443..3035540 | - | 1098 | WP_022645522.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T258922 WP_000613626.1 NZ_CP104665:3030239-3030733 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0T0H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A1AEM7 |