Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1142679..1143262 | Replicon | chromosome |
Accession | NZ_CP104665 | ||
Organism | Escherichia coli strain 2021CK-00607 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V0SV58 |
Locus tag | N5914_RS05460 | Protein ID | WP_000254750.1 |
Coordinates | 1142927..1143262 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | N5914_RS05455 | Protein ID | WP_000581937.1 |
Coordinates | 1142679..1142927 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5914_RS05445 (1139018) | 1139018..1140319 | + | 1302 | WP_000046818.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
N5914_RS05450 (1140367) | 1140367..1142601 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
N5914_RS05455 (1142679) | 1142679..1142927 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N5914_RS05460 (1142927) | 1142927..1143262 | + | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
N5914_RS05465 (1143334) | 1143334..1144125 | + | 792 | WP_001071641.1 | nucleoside triphosphate pyrophosphohydrolase | - |
N5914_RS05470 (1144353) | 1144353..1145990 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
N5914_RS05475 (1146077) | 1146077..1147375 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T258916 WP_000254750.1 NZ_CP104665:1142927-1143262 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|