Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 991788..992442 | Replicon | chromosome |
Accession | NZ_CP104665 | ||
Organism | Escherichia coli strain 2021CK-00607 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | N5914_RS04780 | Protein ID | WP_000244781.1 |
Coordinates | 992035..992442 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | N5914_RS04775 | Protein ID | WP_000354046.1 |
Coordinates | 991788..992054 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5914_RS04755 (987866) | 987866..989299 | - | 1434 | WP_022646090.1 | 6-phospho-beta-glucosidase BglA | - |
N5914_RS04760 (989344) | 989344..989655 | + | 312 | WP_001182953.1 | N(4)-acetylcytidine aminohydrolase | - |
N5914_RS04765 (989819) | 989819..990478 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
N5914_RS04770 (990555) | 990555..991535 | - | 981 | WP_000886050.1 | tRNA-modifying protein YgfZ | - |
N5914_RS04775 (991788) | 991788..992054 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
N5914_RS04780 (992035) | 992035..992442 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
N5914_RS04785 (992482) | 992482..993003 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
N5914_RS04790 (993115) | 993115..994011 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
N5914_RS04795 (994036) | 994036..994746 | + | 711 | WP_000715222.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N5914_RS04800 (994752) | 994752..996485 | + | 1734 | WP_000813233.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T258915 WP_000244781.1 NZ_CP104665:992035-992442 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|