Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 849951..850786 Replicon chromosome
Accession NZ_CP104665
Organism Escherichia coli strain 2021CK-00607

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0A1A9A5
Locus tag N5914_RS04015 Protein ID WP_001564063.1
Coordinates 849951..850328 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0A1AEL8
Locus tag N5914_RS04020 Protein ID WP_038432125.1
Coordinates 850418..850786 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5914_RS03985 (845080) 845080..846228 - 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -
N5914_RS03990 (846300) 846300..847283 - 984 WP_001296394.1 KpsF/GutQ family sugar-phosphate isomerase -
N5914_RS03995 (848093) 848093..848263 - 171 Protein_785 IS110 family transposase -
N5914_RS04000 (848605) 848605..849447 - 843 Protein_786 DUF4942 domain-containing protein -
N5914_RS04005 (849532) 849532..849726 - 195 WP_024181941.1 DUF957 domain-containing protein -
N5914_RS04010 (849805) 849805..849954 - 150 Protein_788 DUF5983 family protein -
N5914_RS04015 (849951) 849951..850328 - 378 WP_001564063.1 TA system toxin CbtA family protein Toxin
N5914_RS04020 (850418) 850418..850786 - 369 WP_038432125.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N5914_RS04025 (850949) 850949..851170 - 222 WP_000692345.1 DUF987 domain-containing protein -
N5914_RS04030 (851235) 851235..851711 - 477 WP_001186774.1 RadC family protein -
N5914_RS04035 (851727) 851727..852206 - 480 WP_033869257.1 antirestriction protein -
N5914_RS04040 (852472) 852472..853290 - 819 WP_001175165.1 DUF932 domain-containing protein -
N5914_RS04045 (853380) 853380..853613 - 234 WP_001278293.1 DUF905 family protein -
N5914_RS04050 (853619) 853619..854296 - 678 WP_001564058.1 hypothetical protein -
N5914_RS04055 (854447) 854447..855127 - 681 WP_001278649.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papX 848478..915033 66555
- flank IS/Tn - - 848093..848248 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14094.09 Da        Isoelectric Point: 7.8045

>T258914 WP_001564063.1 NZ_CP104665:c850328-849951 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13569.31 Da        Isoelectric Point: 7.0369

>AT258914 WP_038432125.1 NZ_CP104665:c850786-850418 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A1A9A5

Antitoxin

Source ID Structure
AlphaFold DB A0A0A1AEL8

References