Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 39737..40473 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104661 | ||
| Organism | Klebsiella pneumoniae strain 2021CK-01729 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | N4T33_RS26020 | Protein ID | WP_003026803.1 |
| Coordinates | 39991..40473 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | N4T33_RS26015 | Protein ID | WP_003026799.1 |
| Coordinates | 39737..40003 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T33_RS26005 (N4T33_26010) | 35719..36297 | - | 579 | WP_004206571.1 | recombinase family protein | - |
| N4T33_RS26010 (N4T33_26015) | 36456..39440 | + | 2985 | Protein_40 | Tn3 family transposase | - |
| N4T33_RS26015 (N4T33_26020) | 39737..40003 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| N4T33_RS26020 (N4T33_26025) | 39991..40473 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| N4T33_RS26025 (N4T33_26030) | 40674..42077 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| N4T33_RS26030 (N4T33_26035) | 42106..42738 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| N4T33_RS26035 (N4T33_26040) | 43020..43277 | - | 258 | WP_023292103.1 | hypothetical protein | - |
| N4T33_RS26040 (N4T33_26045) | 43755..44483 | + | 729 | Protein_46 | CSS-motif domain-containing protein | - |
| N4T33_RS26045 (N4T33_26050) | 44499..45335 | + | 837 | WP_032409249.1 | EAL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..186135 | 186135 | |
| - | inside | IScluster/Tn | - | - | 35719..42077 | 6358 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T258910 WP_003026803.1 NZ_CP104661:39991-40473 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |