Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5303476..5304101 | Replicon | chromosome |
Accession | NZ_CP104660 | ||
Organism | Klebsiella pneumoniae strain 2021CK-01729 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A378FVD4 |
Locus tag | N4T33_RS25445 | Protein ID | WP_019705794.1 |
Coordinates | 5303476..5303859 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N4T33_RS25450 | Protein ID | WP_168234151.1 |
Coordinates | 5303859..5304101 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T33_RS25430 (N4T33_25435) | 5300842..5301744 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
N4T33_RS25435 (N4T33_25440) | 5301741..5302376 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
N4T33_RS25440 (N4T33_25445) | 5302373..5303302 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
N4T33_RS25445 (N4T33_25450) | 5303476..5303859 | - | 384 | WP_019705794.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
N4T33_RS25450 (N4T33_25455) | 5303859..5304101 | - | 243 | WP_168234151.1 | CopG family transcriptional regulator | Antitoxin |
N4T33_RS25455 (N4T33_25460) | 5304306..5305223 | + | 918 | WP_019705795.1 | alpha/beta hydrolase | - |
N4T33_RS25460 (N4T33_25465) | 5305237..5306178 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
N4T33_RS25465 (N4T33_25470) | 5306223..5306660 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
N4T33_RS25470 (N4T33_25475) | 5306657..5307517 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
N4T33_RS25475 (N4T33_25480) | 5307511..5308110 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14358.57 Da Isoelectric Point: 6.8806
>T258909 WP_019705794.1 NZ_CP104660:c5303859-5303476 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGHREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|