Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4819753..4820269 | Replicon | chromosome |
Accession | NZ_CP104660 | ||
Organism | Klebsiella pneumoniae strain 2021CK-01729 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | N4T33_RS23150 | Protein ID | WP_009486548.1 |
Coordinates | 4819753..4820037 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A331AB37 |
Locus tag | N4T33_RS23155 | Protein ID | WP_019704689.1 |
Coordinates | 4820027..4820269 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T33_RS23125 (N4T33_23130) | 4815149..4815412 | - | 264 | WP_020802733.1 | PTS sugar transporter subunit IIB | - |
N4T33_RS23130 (N4T33_23135) | 4815542..4815655 | + | 114 | Protein_4536 | hypothetical protein | - |
N4T33_RS23135 (N4T33_23140) | 4815718..4816461 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
N4T33_RS23140 (N4T33_23145) | 4816818..4818956 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N4T33_RS23145 (N4T33_23150) | 4819285..4819749 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N4T33_RS23150 (N4T33_23155) | 4819753..4820037 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4T33_RS23155 (N4T33_23160) | 4820027..4820269 | - | 243 | WP_019704689.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N4T33_RS23160 (N4T33_23165) | 4820347..4822257 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
N4T33_RS23165 (N4T33_23170) | 4822280..4823434 | - | 1155 | WP_019704690.1 | lactonase family protein | - |
N4T33_RS23170 (N4T33_23175) | 4823501..4824241 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T258907 WP_009486548.1 NZ_CP104660:c4820037-4819753 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331AB37 |