Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 777201..777858 | Replicon | chromosome |
Accession | NZ_CP104660 | ||
Organism | Klebsiella pneumoniae strain 2021CK-01729 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | N4T33_RS03850 | Protein ID | WP_002916310.1 |
Coordinates | 777448..777858 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | N4T33_RS03845 | Protein ID | WP_002916312.1 |
Coordinates | 777201..777467 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T33_RS03820 (N4T33_03820) | 772409..773842 | - | 1434 | WP_019704912.1 | 6-phospho-beta-glucosidase BglA | - |
N4T33_RS03825 (N4T33_03825) | 773961..774689 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
N4T33_RS03830 (N4T33_03830) | 774739..775050 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
N4T33_RS03835 (N4T33_03835) | 775214..775873 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
N4T33_RS03840 (N4T33_03840) | 775972..776955 | - | 984 | WP_016530681.1 | tRNA-modifying protein YgfZ | - |
N4T33_RS03845 (N4T33_03845) | 777201..777467 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
N4T33_RS03850 (N4T33_03850) | 777448..777858 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
N4T33_RS03855 (N4T33_03855) | 777865..778386 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
N4T33_RS03860 (N4T33_03860) | 778487..779383 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
N4T33_RS03865 (N4T33_03865) | 779406..780119 | + | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N4T33_RS03870 (N4T33_03870) | 780125..781858 | + | 1734 | WP_019704911.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T258898 WP_002916310.1 NZ_CP104660:777448-777858 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |