Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 5286437..5287056 Replicon chromosome
Accession NZ_CP104659
Organism Klebsiella pneumoniae strain 2020CK-00096

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N5936_RS25640 Protein ID WP_002892050.1
Coordinates 5286437..5286655 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N5936_RS25645 Protein ID WP_002892066.1
Coordinates 5286682..5287056 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5936_RS25605 (5282484) 5282484..5282747 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
N5936_RS25610 (5282747) 5282747..5282887 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N5936_RS25615 (5282884) 5282884..5283582 - 699 WP_032435564.1 GNAT family protein -
N5936_RS25620 (5283683) 5283683..5285134 + 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
N5936_RS25625 (5285109) 5285109..5285579 - 471 WP_002892026.1 YlaC family protein -
N5936_RS25630 (5285600) 5285600..5285740 + 141 WP_004147370.1 hypothetical protein -
N5936_RS25635 (5285712) 5285712..5286278 - 567 WP_002892030.1 maltose O-acetyltransferase -
N5936_RS25640 (5286437) 5286437..5286655 - 219 WP_002892050.1 HHA domain-containing protein Toxin
N5936_RS25645 (5286682) 5286682..5287056 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N5936_RS25650 (5287542) 5287542..5290688 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
N5936_RS25655 (5290711) 5290711..5291904 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 5281378..5282424 1046


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T258895 WP_002892050.1 NZ_CP104659:c5286655-5286437 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT258895 WP_002892066.1 NZ_CP104659:c5287056-5286682 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References