Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4613367..4614070 | Replicon | chromosome |
| Accession | NZ_CP104659 | ||
| Organism | Klebsiella pneumoniae strain 2020CK-00096 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A939NMR5 |
| Locus tag | N5936_RS22420 | Protein ID | WP_071994632.1 |
| Coordinates | 4613729..4614070 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
| Locus tag | N5936_RS22415 | Protein ID | WP_032434296.1 |
| Coordinates | 4613367..4613708 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5936_RS22380 (4608522) | 4608522..4609396 | + | 875 | Protein_4368 | GTPase family protein | - |
| N5936_RS22385 (4609640) | 4609640..4610356 | + | 717 | WP_032434305.1 | WYL domain-containing protein | - |
| N5936_RS22390 (4610392) | 4610392..4610844 | + | 453 | WP_032410767.1 | hypothetical protein | - |
| N5936_RS22395 (4610916) | 4610916..4611389 | + | 474 | WP_032434303.1 | hypothetical protein | - |
| N5936_RS22400 (4611509) | 4611509..4612330 | + | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
| N5936_RS22405 (4612361) | 4612361..4612801 | + | 441 | WP_032434300.1 | antirestriction protein | - |
| N5936_RS22410 (4612814) | 4612814..4613356 | + | 543 | WP_032434298.1 | DNA repair protein RadC | - |
| N5936_RS22415 (4613367) | 4613367..4613708 | + | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| N5936_RS22420 (4613729) | 4613729..4614070 | + | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
| N5936_RS22425 (4614262) | 4614262..4616295 | - | 2034 | WP_050598589.1 | hypothetical protein | - |
| N5936_RS22430 (4616886) | 4616886..4617755 | - | 870 | WP_023317468.1 | HNH endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | blaCTX-M-15 | - | 4577797..4626351 | 48554 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T258893 WP_071994632.1 NZ_CP104659:4613729-4614070 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|