Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4517848..4518364 | Replicon | chromosome |
| Accession | NZ_CP104659 | ||
| Organism | Klebsiella pneumoniae strain 2020CK-00096 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | N5936_RS22015 | Protein ID | WP_004178374.1 |
| Coordinates | 4518080..4518364 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A919M0P8 |
| Locus tag | N5936_RS22010 | Protein ID | WP_032434351.1 |
| Coordinates | 4517848..4518090 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5936_RS21995 (4513877) | 4513877..4514617 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
| N5936_RS22000 (4514683) | 4514683..4515837 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
| N5936_RS22005 (4515860) | 4515860..4517770 | + | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| N5936_RS22010 (4517848) | 4517848..4518090 | + | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N5936_RS22015 (4518080) | 4518080..4518364 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5936_RS22020 (4518368) | 4518368..4518832 | - | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| N5936_RS22025 (4519074) | 4519074..4521212 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| N5936_RS22030 (4521569) | 4521569..4522312 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| N5936_RS22035 (4522315) | 4522315..4522488 | - | 174 | WP_032414379.1 | hypothetical protein | - |
| N5936_RS22040 (4522573) | 4522573..4522881 | + | 309 | WP_012737232.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T258892 WP_004178374.1 NZ_CP104659:4518080-4518364 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|