Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3157028..3157685 | Replicon | chromosome |
| Accession | NZ_CP104659 | ||
| Organism | Klebsiella pneumoniae strain 2020CK-00096 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | N5936_RS15375 | Protein ID | WP_002916310.1 |
| Coordinates | 3157028..3157438 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | N5936_RS15380 | Protein ID | WP_002916312.1 |
| Coordinates | 3157419..3157685 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5936_RS15355 (3153028) | 3153028..3154761 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N5936_RS15360 (3154767) | 3154767..3155480 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5936_RS15365 (3155503) | 3155503..3156399 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| N5936_RS15370 (3156500) | 3156500..3157021 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
| N5936_RS15375 (3157028) | 3157028..3157438 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
| N5936_RS15380 (3157419) | 3157419..3157685 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| N5936_RS15385 (3157931) | 3157931..3158914 | + | 984 | WP_023286864.1 | tRNA-modifying protein YgfZ | - |
| N5936_RS15390 (3159013) | 3159013..3159672 | - | 660 | WP_004174454.1 | hemolysin III family protein | - |
| N5936_RS15395 (3159836) | 3159836..3160147 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| N5936_RS15400 (3160197) | 3160197..3160925 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| N5936_RS15405 (3161044) | 3161044..3162477 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T258887 WP_002916310.1 NZ_CP104659:c3157438-3157028 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |