Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 91531..92119 | Replicon | plasmid unnamed2 |
Accession | NZ_CP104653 | ||
Organism | Acinetobacter variabilis strain 2021CK-01005 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | N8SM64 |
Locus tag | N5980_RS16830 | Protein ID | WP_000438825.1 |
Coordinates | 91531..91818 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | D3JXQ4 |
Locus tag | N5980_RS16835 | Protein ID | WP_004728120.1 |
Coordinates | 91805..92119 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5980_RS16810 (N5980_16795) | 87535..88314 | + | 780 | WP_000422636.1 | aminoglycoside O-phosphotransferase APH(3')-VIa | - |
N5980_RS16815 (N5980_16800) | 88451..89419 | + | 969 | WP_012308653.1 | IS30 family transposase | - |
N5980_RS16820 (N5980_16805) | 89416..89814 | + | 399 | WP_080768162.1 | LysE family transporter | - |
N5980_RS16825 (N5980_16810) | 89949..91274 | + | 1326 | WP_234622163.1 | ISNCY family transposase | - |
N5980_RS16830 (N5980_16815) | 91531..91818 | + | 288 | WP_000438825.1 | BrnT family toxin | Toxin |
N5980_RS16835 (N5980_16820) | 91805..92119 | + | 315 | WP_004728120.1 | BrnA antitoxin family protein | Antitoxin |
N5980_RS16840 (N5980_16825) | 92208..92738 | - | 531 | WP_000172759.1 | hypothetical protein | - |
N5980_RS16845 (N5980_16830) | 92887..93189 | + | 303 | WP_000286964.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N5980_RS16850 (N5980_16835) | 93190..93471 | + | 282 | WP_000985609.1 | putative addiction module antidote protein | - |
N5980_RS16855 (N5980_16840) | 93571..94779 | + | 1209 | WP_042090285.1 | IS256 family transposase | - |
N5980_RS16860 (N5980_16845) | 94890..96215 | - | 1326 | WP_234622163.1 | ISNCY family transposase | - |
N5980_RS16865 (N5980_16850) | 96376..96795 | - | 420 | WP_001180106.1 | SMI1/KNR4 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaOXA-58 / blaNDM-1 / aph(3')-VIa / msr(E) / mph(E) / aph(6)-Id / aph(3'')-Ib / aac(3)-IId | - | 1..123124 | 123124 | |
- | inside | IScluster/Tn | aph(3')-VIa / msr(E) / mph(E) / aph(6)-Id / aph(3'')-Ib / aac(3)-IId | - | 86409..116064 | 29655 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11304.70 Da Isoelectric Point: 5.6205
>T258878 WP_000438825.1 NZ_CP104653:91531-91818 [Acinetobacter variabilis]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTDGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRHTDGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A8TVQ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0A8TRI9 |