258877

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA(toxin)
Location 143788..144365 Replicon plasmid unnamed1
Accession NZ_CP104652
Organism Acinetobacter variabilis strain 2021CK-01005

Toxin (Protein)


Gene name hicA Uniprot ID N8ZPI0
Locus tag N5980_RS16140 Protein ID WP_004812233.1
Coordinates 143788..144036 (+) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID N8ZW11
Locus tag N5980_RS16145 Protein ID WP_004812232.1
Coordinates 144033..144365 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5980_RS16105 (N5980_16095) 139856..140047 + 192 WP_004812236.1 hypothetical protein -
N5980_RS16110 (N5980_16100) 140179..140472 - 294 Protein_141 IS5/IS1182 family transposase -
N5980_RS16115 (N5980_16105) 140569..141273 + 705 WP_001067784.1 IS6-like element IS1006 family transposase -
N5980_RS16120 (N5980_16110) 141385..141951 + 567 WP_010700350.1 recombinase family protein -
N5980_RS16125 (N5980_16115) 142284..142511 + 228 WP_004812234.1 hypothetical protein -
N5980_RS16130 (N5980_16120) 142744..143175 - 432 WP_000042163.1 MarR family transcriptional regulator -
N5980_RS16135 (N5980_16125) 143182..143610 - 429 WP_004786455.1 organic hydroperoxide resistance protein -
N5980_RS16140 (N5980_16130) 143788..144036 + 249 WP_004812233.1 type II toxin-antitoxin system HicA family toxin Toxin
N5980_RS16145 (N5980_16135) 144033..144365 + 333 WP_004812232.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N5980_RS16150 (N5980_16140) 144494..144688 - 195 Protein_149 arsenical-resistance protein -
N5980_RS16155 (N5980_16145) 144741..145094 - 354 Protein_150 IS6-like element IS1008 family transposase -
N5980_RS16160 (N5980_16150) 145149..146081 - 933 WP_004812228.1 IS5-like element ISAha3 family transposase -
N5980_RS16165 (N5980_16155) 146137..146601 + 465 WP_261635554.1 hypothetical protein -
N5980_RS16170 (N5980_16160) 146714..147232 - 519 WP_004812221.1 tetratricopeptide repeat protein -
N5980_RS16175 (N5980_16165) 147833..148018 - 186 Protein_154 helix-turn-helix domain-containing protein -
N5980_RS16180 (N5980_16170) 148140..148601 + 462 WP_000761345.1 DIP1984 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..185297 185297
- inside IScluster/Tn - - 140179..165892 25713


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-78)

Antitoxin

Uncharacterised protein family HicB

(54-101)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9436.02 Da        Isoelectric Point: 10.1337

>T258877 WP_004812233.1 NZ_CP104652:143788-144036 [Acinetobacter variabilis]
MGKTEKLLEKFGNSKNTFPYKDLVVLLSQLGYEKFEMAGSRVRFFNEKTEHMILLHRPHPENEIKGGALKAVKQALKQEG
FL

Download         Length: 249 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12224.97 Da        Isoelectric Point: 4.8951

>AT258877 WP_004812232.1 NZ_CP104652:144033-144365 [Acinetobacter variabilis]
MSYLKYKGYLGTIEPDLETGELFGKLAFIRDLITYEAETLKALEKAFQESVDGYLESCAELGKSPDQPFKGTFNVRISPE
LHRKAVLASSNSLNAFVSDAIQEKLMRLGA

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB N8ZPI0

Antitoxin

Source ID Structure
AlphaFold DB N8ZW11

References