Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 2738779..2739401 Replicon chromosome
Accession NZ_CP104651
Organism Acinetobacter variabilis strain 2021CK-01005

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N5980_RS13300 Protein ID WP_140948450.1
Coordinates 2739006..2739401 (+) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N5980_RS13295 Protein ID WP_104427085.1
Coordinates 2738779..2739009 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5980_RS13260 (N5980_13250) 2734118..2735002 - 885 WP_001447541.1 DUF3363 domain-containing protein -
N5980_RS13265 (N5980_13255) 2735033..2735863 - 831 Protein_2556 IS91-like element ISVsa3 family transposase -
N5980_RS13270 (N5980_13260) 2735927..2736631 + 705 WP_001067784.1 IS6-like element IS1006 family transposase -
N5980_RS13275 (N5980_13265) 2736685..2736813 + 129 Protein_2558 RepB family plasmid replication initiator protein -
N5980_RS13280 (N5980_13270) 2736806..2737360 + 555 WP_136144359.1 plasmid replication DNA-binding protein -
N5980_RS13285 (N5980_13275) 2737373..2737516 + 144 WP_171476913.1 hypothetical protein -
N5980_RS13290 (N5980_13280) 2737700..2738125 - 426 WP_065995587.1 DUF6530 family protein -
N5980_RS13295 (N5980_13285) 2738779..2739009 + 231 WP_104427085.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5980_RS13300 (N5980_13290) 2739006..2739401 + 396 WP_140948450.1 type II toxin-antitoxin system VapC family toxin Toxin
N5980_RS13305 (N5980_13295) 2739483..2740151 - 669 WP_213702720.1 hypothetical protein -
N5980_RS13310 (N5980_13300) 2740114..2740773 + 660 Protein_2565 ATP-binding protein -
N5980_RS13315 (N5980_13305) 2740878..2741699 - 822 WP_085562421.1 OXA-23 family carbapenem-hydrolyzing class D beta-lactamase OXA-565 -
N5980_RS13320 (N5980_13310) 2741805..2742895 + 1091 WP_085940648.1 IS4-like element ISAba1 family transposase -
N5980_RS13325 (N5980_13315) 2742924..2743721 - 798 Protein_2568 class I SAM-dependent DNA methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island sul2 / floR / blaOXA-565 - 2707250..2748442 41192
- inside IScluster/Tn sul2 / floR / blaOXA-565 - 2728189..2742895 14706


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-124)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14925.20 Da        Isoelectric Point: 6.2238

>T258876 WP_140948450.1 NZ_CP104651:2739006-2739401 [Acinetobacter variabilis]
MIYLLDTNICIYVINHKPQQVFERFKQYQLGQLAISSITASELAFGVEKSGSERNKQALNKFLSPLDILPYDEQAIWHYA
KLRQDLQSTGKTIGSLDMLIAAHALALDVVLVTNNIKEFERIDGLKLENWT

Download         Length: 396 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8733.00 Da        Isoelectric Point: 4.7708

>AT258876 WP_104427085.1 NZ_CP104651:2738779-2739009 [Acinetobacter variabilis]
METAKVFQTGRSQAVRLPKAFRFNGTEVAIKSFGRGVLLMPIENPWDIMLEAINEFEVGFQLERADQGEQLREDFK

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References