Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2738779..2739401 | Replicon | chromosome |
| Accession | NZ_CP104651 | ||
| Organism | Acinetobacter variabilis strain 2021CK-01005 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N5980_RS13300 | Protein ID | WP_140948450.1 |
| Coordinates | 2739006..2739401 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N5980_RS13295 | Protein ID | WP_104427085.1 |
| Coordinates | 2738779..2739009 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5980_RS13260 (N5980_13250) | 2734118..2735002 | - | 885 | WP_001447541.1 | DUF3363 domain-containing protein | - |
| N5980_RS13265 (N5980_13255) | 2735033..2735863 | - | 831 | Protein_2556 | IS91-like element ISVsa3 family transposase | - |
| N5980_RS13270 (N5980_13260) | 2735927..2736631 | + | 705 | WP_001067784.1 | IS6-like element IS1006 family transposase | - |
| N5980_RS13275 (N5980_13265) | 2736685..2736813 | + | 129 | Protein_2558 | RepB family plasmid replication initiator protein | - |
| N5980_RS13280 (N5980_13270) | 2736806..2737360 | + | 555 | WP_136144359.1 | plasmid replication DNA-binding protein | - |
| N5980_RS13285 (N5980_13275) | 2737373..2737516 | + | 144 | WP_171476913.1 | hypothetical protein | - |
| N5980_RS13290 (N5980_13280) | 2737700..2738125 | - | 426 | WP_065995587.1 | DUF6530 family protein | - |
| N5980_RS13295 (N5980_13285) | 2738779..2739009 | + | 231 | WP_104427085.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| N5980_RS13300 (N5980_13290) | 2739006..2739401 | + | 396 | WP_140948450.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N5980_RS13305 (N5980_13295) | 2739483..2740151 | - | 669 | WP_213702720.1 | hypothetical protein | - |
| N5980_RS13310 (N5980_13300) | 2740114..2740773 | + | 660 | Protein_2565 | ATP-binding protein | - |
| N5980_RS13315 (N5980_13305) | 2740878..2741699 | - | 822 | WP_085562421.1 | OXA-23 family carbapenem-hydrolyzing class D beta-lactamase OXA-565 | - |
| N5980_RS13320 (N5980_13310) | 2741805..2742895 | + | 1091 | WP_085940648.1 | IS4-like element ISAba1 family transposase | - |
| N5980_RS13325 (N5980_13315) | 2742924..2743721 | - | 798 | Protein_2568 | class I SAM-dependent DNA methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | sul2 / floR / blaOXA-565 | - | 2707250..2748442 | 41192 | |
| - | inside | IScluster/Tn | sul2 / floR / blaOXA-565 | - | 2728189..2742895 | 14706 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14925.20 Da Isoelectric Point: 6.2238
>T258876 WP_140948450.1 NZ_CP104651:2739006-2739401 [Acinetobacter variabilis]
MIYLLDTNICIYVINHKPQQVFERFKQYQLGQLAISSITASELAFGVEKSGSERNKQALNKFLSPLDILPYDEQAIWHYA
KLRQDLQSTGKTIGSLDMLIAAHALALDVVLVTNNIKEFERIDGLKLENWT
MIYLLDTNICIYVINHKPQQVFERFKQYQLGQLAISSITASELAFGVEKSGSERNKQALNKFLSPLDILPYDEQAIWHYA
KLRQDLQSTGKTIGSLDMLIAAHALALDVVLVTNNIKEFERIDGLKLENWT
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|