Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 521839..522475 | Replicon | chromosome |
| Accession | NZ_CP104651 | ||
| Organism | Acinetobacter variabilis strain 2021CK-01005 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | N5980_RS02535 | Protein ID | WP_175966132.1 |
| Coordinates | 522089..522475 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | N5980_RS02530 | Protein ID | WP_125278962.1 |
| Coordinates | 521839..522096 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5980_RS02510 (N5980_02510) | 517341..518348 | + | 1008 | WP_004786889.1 | DNA-directed RNA polymerase subunit alpha | - |
| N5980_RS02515 (N5980_02515) | 518367..518732 | + | 366 | WP_004786886.1 | 50S ribosomal protein L17 | - |
| N5980_RS02520 (N5980_02520) | 518940..520430 | + | 1491 | WP_175966134.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| N5980_RS02525 (N5980_02525) | 520484..521656 | - | 1173 | WP_005233750.1 | acyl-CoA dehydrogenase family protein | - |
| N5980_RS02530 (N5980_02530) | 521839..522096 | + | 258 | WP_125278962.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| N5980_RS02535 (N5980_02535) | 522089..522475 | + | 387 | WP_175966132.1 | hypothetical protein | Toxin |
| N5980_RS02540 (N5980_02540) | 523022..524062 | + | 1041 | WP_175966130.1 | hypothetical protein | - |
| N5980_RS02545 (N5980_02545) | 524135..524707 | + | 573 | WP_005233757.1 | rhombosortase | - |
| N5980_RS02550 (N5980_02550) | 524885..527167 | + | 2283 | WP_175966128.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 15204.28 Da Isoelectric Point: 10.0581
>T258875 WP_175966132.1 NZ_CP104651:522089-522475 [Acinetobacter variabilis]
MDNRCFKLRRSKCALVFQLFIFAVLMFLLYQLLPVTIWLVCGVIGLVIYQLFYRKTPHIEQFEYLDGREWSLTAAAQGTR
RVLISHVIDHQAYIVVYFQHAKARPLLIWCDQLPFKQWKSLKVLTKIL
MDNRCFKLRRSKCALVFQLFIFAVLMFLLYQLLPVTIWLVCGVIGLVIYQLFYRKTPHIEQFEYLDGREWSLTAAAQGTR
RVLISHVIDHQAYIVVYFQHAKARPLLIWCDQLPFKQWKSLKVLTKIL
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|