Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 6620..7179 Replicon plasmid unnamed1
Accession NZ_CP104650
Organism Escherichia coli strain PNUSAE008512

Toxin (Protein)


Gene name relE Uniprot ID O82928
Locus tag N5913_RS27530 Protein ID WP_000421248.1
Coordinates 6904..7179 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag N5913_RS27525 Protein ID WP_001178089.1
Coordinates 6620..6904 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5913_RS27485 (1811) 1811..2371 + 561 WP_000840472.1 fertility inhibition protein FinO -
N5913_RS27490 (2504) 2504..2716 + 213 WP_001302189.1 ANR family transcriptional regulator -
N5913_RS27495 (2961) 2961..3422 + 462 WP_001233856.1 thermonuclease family protein -
N5913_RS27500 (3468) 3468..3677 + 210 WP_001302200.1 hemolysin expression modulator Hha -
N5913_RS27505 (3715) 3715..4053 + 339 WP_000766796.1 hypothetical protein -
N5913_RS27510 (4293) 4293..4547 + 255 WP_000083831.1 replication regulatory protein RepA -
N5913_RS27515 (4783) 4783..4857 + 75 WP_001370046.1 RepA leader peptide Tap -
N5913_RS27520 (4850) 4850..5707 + 858 WP_000130945.1 incFII family plasmid replication initiator RepA -
N5913_RS27525 (6620) 6620..6904 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
N5913_RS27530 (6904) 6904..7179 + 276 WP_000421248.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5913_RS27535 (7274) 7274..7480 + 207 WP_001105064.1 hypothetical protein -
N5913_RS27540 (7580) 7580..7795 - 216 Protein_14 transposase -
N5913_RS27545 (7839) 7839..8405 - 567 Protein_15 IS3-like element IS600 family transposase -
N5913_RS27550 (8405) 8405..8821 - 417 Protein_16 IS91 family transposase -
N5913_RS27555 (8821) 8821..9006 - 186 WP_001302179.1 hypothetical protein -
N5913_RS27560 (9183) 9183..11393 + 2211 WP_000592771.1 catalase/peroxidase KatP -
N5913_RS27565 (11437) 11437..11826 + 390 WP_001172748.1 cytochrome b562 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espP / stcE / exeE / exeG / hlyC / hlyA / hlyB / hlyD / toxB 1..94645 94645


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10735.42 Da        Isoelectric Point: 9.9324

>T258874 WP_000421248.1 NZ_CP104650:6904-7179 [Escherichia coli]
MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT258874 WP_001178089.1 NZ_CP104650:6620-6904 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6FAZ0

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References