Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 5450250..5450728 Replicon chromosome
Accession NZ_CP104649
Organism Escherichia coli strain PNUSAE008512

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A891SFN9
Locus tag N5913_RS27205 Protein ID WP_001303876.1
Coordinates 5450250..5450537 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID Q8XD67
Locus tag N5913_RS27210 Protein ID WP_000536233.1
Coordinates 5450537..5450728 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5913_RS27170 (5445399) 5445399..5447870 - 2472 WP_000034474.1 exonuclease -
N5913_RS27175 (5447964) 5447964..5448155 - 192 WP_001098307.1 DUF1482 family protein -
N5913_RS27180 (5448152) 5448152..5448340 - 189 WP_000413705.1 cell division inhibition protein DicB -
N5913_RS27185 (5448914) 5448914..5449099 + 186 WP_001133046.1 hypothetical protein -
N5913_RS27190 (5449286) 5449286..5449675 - 390 WP_000394511.1 hypothetical protein -
N5913_RS27195 (5449687) 5449687..5449815 - 129 WP_000344963.1 protein YdfB -
N5913_RS27200 (5449817) 5449817..5449972 - 156 WP_000379575.1 DUF1391 family protein -
N5913_RS27205 (5450250) 5450250..5450537 - 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5913_RS27210 (5450537) 5450537..5450728 - 192 WP_000536233.1 hypothetical protein Antitoxin
N5913_RS27215 (5450756) 5450756..5451157 - 402 WP_000986592.1 helix-turn-helix domain-containing protein -
N5913_RS27220 (5451266) 5451266..5451538 + 273 WP_000887453.1 YdaS family helix-turn-helix protein -
N5913_RS27225 (5451522) 5451522..5451947 + 426 WP_000693855.1 toxin YdaT family protein -
N5913_RS27230 (5452154) 5452154..5452609 - 456 WP_000273724.1 hypothetical protein -
N5913_RS27235 (5452688) 5452688..5453785 + 1098 WP_001475117.1 hypothetical protein -
N5913_RS27240 (5453792) 5453792..5454538 + 747 WP_000788745.1 ATP-binding protein -
N5913_RS27245 (5454560) 5454560..5455330 + 771 WP_000450992.1 DUF1627 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 5445089..5462188 17099


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10978.84 Da        Isoelectric Point: 10.1360

>T258872 WP_001303876.1 NZ_CP104649:c5450537-5450250 [Escherichia coli]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7025.80 Da        Isoelectric Point: 4.0270

>AT258872 WP_000536233.1 NZ_CP104649:c5450728-5450537 [Escherichia coli]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNKSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References