Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 5283884..5284589 | Replicon | chromosome |
Accession | NZ_CP104649 | ||
Organism | Escherichia coli strain PNUSAE008512 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q8X3N0 |
Locus tag | N5913_RS26455 | Protein ID | WP_000539519.1 |
Coordinates | 5284203..5284589 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N5913_RS26450 | Protein ID | WP_001280945.1 |
Coordinates | 5283884..5284213 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5913_RS26435 (5279041) | 5279041..5279952 | + | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
N5913_RS26440 (5280130) | 5280130..5282478 | + | 2349 | WP_000950320.1 | EAL domain-containing protein | - |
N5913_RS26445 (5282486) | 5282486..5283814 | + | 1329 | WP_000086905.1 | GGDEF domain-containing protein | - |
N5913_RS26450 (5283884) | 5283884..5284213 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
N5913_RS26455 (5284203) | 5284203..5284589 | - | 387 | WP_000539519.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5913_RS26460 (5284815) | 5284815..5286140 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
N5913_RS26465 (5286353) | 5286353..5286736 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
N5913_RS26470 (5286847) | 5286847..5287962 | + | 1116 | WP_000554959.1 | aldose sugar dehydrogenase YliI | - |
N5913_RS26475 (5287959) | 5287959..5288585 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14279.42 Da Isoelectric Point: 9.9296
>T258871 WP_000539519.1 NZ_CP104649:c5284589-5284203 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|