Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4084925..4085520 | Replicon | chromosome |
Accession | NZ_CP104649 | ||
Organism | Escherichia coli strain PNUSAE008512 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | N5913_RS20990 | Protein ID | WP_000239579.1 |
Coordinates | 4085170..4085520 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | Q8XCF3 |
Locus tag | N5913_RS20985 | Protein ID | WP_001223210.1 |
Coordinates | 4084925..4085176 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5913_RS20975 (4080590) | 4080590..4084369 | + | 3780 | WP_000060930.1 | autotransporter assembly complex protein TamB | - |
N5913_RS20980 (4084372) | 4084372..4084713 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
N5913_RS20985 (4084925) | 4084925..4085176 | + | 252 | WP_001223210.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
N5913_RS20990 (4085170) | 4085170..4085520 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
N5913_RS20995 (4085600) | 4085600..4086130 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
N5913_RS21000 (4086440) | 4086440..4087396 | + | 957 | WP_000265942.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
N5913_RS21005 (4087536) | 4087536..4089038 | + | 1503 | Protein_4095 | sugar ABC transporter ATP-binding protein | - |
N5913_RS21010 (4089052) | 4089052..4090074 | + | 1023 | WP_001301928.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T258863 WP_000239579.1 NZ_CP104649:4085170-4085520 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|