Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 3125909..3126709 | Replicon | chromosome |
Accession | NZ_CP104649 | ||
Organism | Escherichia coli strain PNUSAE008512 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | A0A891SNC1 |
Locus tag | N5913_RS16410 | Protein ID | WP_000342448.1 |
Coordinates | 3125909..3126436 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4NNI1 |
Locus tag | N5913_RS16415 | Protein ID | WP_001277108.1 |
Coordinates | 3126443..3126709 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5913_RS16385 (3120984) | 3120984..3121751 | - | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
N5913_RS16390 (3121748) | 3121748..3123025 | - | 1278 | WP_000803797.1 | branched chain amino acid ABC transporter permease LivM | - |
N5913_RS16395 (3123022) | 3123022..3123948 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
N5913_RS16400 (3123996) | 3123996..3125105 | - | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
N5913_RS16405 (3125529) | 3125529..3125912 | + | 384 | WP_000778769.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
N5913_RS16410 (3125909) | 3125909..3126436 | - | 528 | WP_000342448.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
N5913_RS16415 (3126443) | 3126443..3126709 | - | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
N5913_RS16420 (3126859) | 3126859..3127962 | - | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
N5913_RS16425 (3128233) | 3128233..3129087 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
N5913_RS16430 (3129332) | 3129332..3130390 | - | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
N5913_RS16435 (3130383) | 3130383..3131051 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19692.68 Da Isoelectric Point: 7.3232
>T258858 WP_000342448.1 NZ_CP104649:c3126436-3125909 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|