Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2587660..2588314 | Replicon | chromosome |
| Accession | NZ_CP104649 | ||
| Organism | Escherichia coli strain PNUSAE008512 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | N5913_RS13680 | Protein ID | WP_000244781.1 |
| Coordinates | 2587660..2588067 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N5913_RS13685 | Protein ID | WP_000354046.1 |
| Coordinates | 2588048..2588314 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5913_RS13660 (2583617) | 2583617..2585350 | - | 1734 | WP_000813185.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N5913_RS13665 (2585356) | 2585356..2586066 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5913_RS13670 (2586091) | 2586091..2586987 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N5913_RS13675 (2587099) | 2587099..2587620 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N5913_RS13680 (2587660) | 2587660..2588067 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| N5913_RS13685 (2588048) | 2588048..2588314 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N5913_RS13690 (2588557) | 2588557..2589537 | + | 981 | WP_000886053.1 | tRNA-modifying protein YgfZ | - |
| N5913_RS13695 (2589614) | 2589614..2590273 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N5913_RS13700 (2590437) | 2590437..2590748 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| N5913_RS13705 (2590793) | 2590793..2592226 | + | 1434 | WP_001310226.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T258854 WP_000244781.1 NZ_CP104649:c2588067-2587660 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|