Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 55164..55723 Replicon plasmid unnamed1
Accession NZ_CP104648
Organism Escherichia coli strain PNUSAE008406

Toxin (Protein)


Gene name relE Uniprot ID O82928
Locus tag N5921_RS27775 Protein ID WP_000421248.1
Coordinates 55164..55439 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag N5921_RS27780 Protein ID WP_001178089.1
Coordinates 55439..55723 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5921_RS27740 (50517) 50517..50906 - 390 WP_001172748.1 cytochrome b562 -
N5921_RS27745 (50950) 50950..53160 - 2211 WP_000592771.1 catalase/peroxidase KatP -
N5921_RS27750 (53337) 53337..53522 + 186 WP_001302179.1 hypothetical protein -
N5921_RS27755 (53522) 53522..53938 + 417 Protein_49 IS91 family transposase -
N5921_RS27760 (53938) 53938..54504 + 567 Protein_50 IS3-like element IS600 family transposase -
N5921_RS27765 (54548) 54548..54763 + 216 Protein_51 transposase -
N5921_RS27770 (54863) 54863..55069 - 207 WP_001105064.1 hypothetical protein -
N5921_RS27775 (55164) 55164..55439 - 276 WP_000421248.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5921_RS27780 (55439) 55439..55723 - 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
N5921_RS27785 (56635) 56635..57492 - 858 WP_000130945.1 incFII family plasmid replication initiator RepA -
N5921_RS27790 (57485) 57485..57559 - 75 WP_001370046.1 RepA leader peptide Tap -
N5921_RS27795 (57795) 57795..58049 - 255 WP_000083831.1 replication regulatory protein RepA -
N5921_RS27800 (58289) 58289..58627 - 339 WP_000766796.1 hypothetical protein -
N5921_RS27805 (58665) 58665..58874 - 210 WP_001302200.1 hemolysin expression modulator Hha -
N5921_RS27810 (58920) 58920..59381 - 462 WP_001233856.1 thermonuclease family protein -
N5921_RS27815 (59626) 59626..59838 - 213 WP_001302189.1 ANR family transcriptional regulator -
N5921_RS27820 (59971) 59971..60531 - 561 WP_000840472.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - hlyD / hlyB / hlyA / hlyC / exeG / exeE / stcE / espP / toxB 1..94647 94647


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10735.42 Da        Isoelectric Point: 9.9324

>T258842 WP_000421248.1 NZ_CP104648:c55439-55164 [Escherichia coli]
MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT258842 WP_001178089.1 NZ_CP104648:c55723-55439 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6FAZ0

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References