Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 4842955..4843593 | Replicon | chromosome |
Accession | NZ_CP104647 | ||
Organism | Escherichia coli strain PNUSAE008406 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N5921_RS24090 | Protein ID | WP_000813794.1 |
Coordinates | 4842955..4843131 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N5921_RS24095 | Protein ID | WP_001270286.1 |
Coordinates | 4843177..4843593 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5921_RS24070 (4838576) | 4838576..4839749 | - | 1174 | Protein_4690 | BenE family transporter YdcO | - |
N5921_RS24075 (4839841) | 4839841..4840377 | + | 537 | WP_000429145.1 | DNA-binding transcriptional regulator SutR | - |
N5921_RS24080 (4840450) | 4840450..4842411 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N5921_RS24085 (4842503) | 4842503..4842733 | - | 231 | WP_000494244.1 | YncJ family protein | - |
N5921_RS24090 (4842955) | 4842955..4843131 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N5921_RS24095 (4843177) | 4843177..4843593 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N5921_RS24100 (4843672) | 4843672..4845078 | + | 1407 | WP_000760654.1 | PLP-dependent aminotransferase family protein | - |
N5921_RS24105 (4845323) | 4845323..4846468 | + | 1146 | WP_000047432.1 | ABC transporter substrate-binding protein | - |
N5921_RS24110 (4846486) | 4846486..4847499 | + | 1014 | WP_000220402.1 | ABC transporter ATP-binding protein | - |
N5921_RS24115 (4847500) | 4847500..4848441 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T258835 WP_000813794.1 NZ_CP104647:4842955-4843131 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT258835 WP_001270286.1 NZ_CP104647:4843177-4843593 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|