Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 4120832..4121310 Replicon chromosome
Accession NZ_CP104647
Organism Escherichia coli strain PNUSAE008406

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A891SFN9
Locus tag N5921_RS20100 Protein ID WP_001303876.1
Coordinates 4120832..4121119 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID Q8XD67
Locus tag N5921_RS20105 Protein ID WP_000536233.1
Coordinates 4121119..4121310 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5921_RS20065 (4115981) 4115981..4118452 - 2472 WP_000034474.1 exonuclease -
N5921_RS20070 (4118546) 4118546..4118737 - 192 WP_001098307.1 DUF1482 family protein -
N5921_RS20075 (4118734) 4118734..4118922 - 189 WP_000413705.1 cell division inhibition protein DicB -
N5921_RS20080 (4119496) 4119496..4119681 + 186 WP_001133046.1 hypothetical protein -
N5921_RS20085 (4119868) 4119868..4120257 - 390 WP_000394511.1 hypothetical protein -
N5921_RS20090 (4120269) 4120269..4120397 - 129 WP_000344963.1 protein YdfB -
N5921_RS20095 (4120399) 4120399..4120554 - 156 WP_000379575.1 DUF1391 family protein -
N5921_RS20100 (4120832) 4120832..4121119 - 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5921_RS20105 (4121119) 4121119..4121310 - 192 WP_000536233.1 hypothetical protein Antitoxin
N5921_RS20110 (4121338) 4121338..4121739 - 402 WP_000986592.1 helix-turn-helix domain-containing protein -
N5921_RS20115 (4121848) 4121848..4122120 + 273 WP_000887453.1 YdaS family helix-turn-helix protein -
N5921_RS20120 (4122104) 4122104..4122529 + 426 WP_000693855.1 toxin YdaT family protein -
N5921_RS20125 (4122736) 4122736..4123191 - 456 WP_000273724.1 hypothetical protein -
N5921_RS20130 (4123270) 4123270..4124367 + 1098 WP_001475117.1 hypothetical protein -
N5921_RS20135 (4124374) 4124374..4125120 + 747 WP_000788745.1 ATP-binding protein -
N5921_RS20140 (4125142) 4125142..4125912 + 771 WP_000450992.1 DUF1627 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10978.84 Da        Isoelectric Point: 10.1360

>T258831 WP_001303876.1 NZ_CP104647:c4121119-4120832 [Escherichia coli]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7025.80 Da        Isoelectric Point: 4.0270

>AT258831 WP_000536233.1 NZ_CP104647:c4121310-4121119 [Escherichia coli]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNKSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References