Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3954466..3955171 | Replicon | chromosome |
Accession | NZ_CP104647 | ||
Organism | Escherichia coli strain PNUSAE008406 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q8X3N0 |
Locus tag | N5921_RS19350 | Protein ID | WP_000539519.1 |
Coordinates | 3954785..3955171 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N5921_RS19345 | Protein ID | WP_001280945.1 |
Coordinates | 3954466..3954795 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5921_RS19330 (3949623) | 3949623..3950534 | + | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
N5921_RS19335 (3950712) | 3950712..3953060 | + | 2349 | WP_000950320.1 | EAL domain-containing protein | - |
N5921_RS19340 (3953068) | 3953068..3954396 | + | 1329 | WP_000086905.1 | GGDEF domain-containing protein | - |
N5921_RS19345 (3954466) | 3954466..3954795 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
N5921_RS19350 (3954785) | 3954785..3955171 | - | 387 | WP_000539519.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5921_RS19355 (3955397) | 3955397..3956722 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
N5921_RS19360 (3956935) | 3956935..3957318 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
N5921_RS19365 (3957429) | 3957429..3958544 | + | 1116 | WP_000554959.1 | aldose sugar dehydrogenase YliI | - |
N5921_RS19370 (3958541) | 3958541..3959167 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14279.42 Da Isoelectric Point: 9.9296
>T258830 WP_000539519.1 NZ_CP104647:c3955171-3954785 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGSKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|