Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 1796471..1797271 | Replicon | chromosome |
Accession | NZ_CP104647 | ||
Organism | Escherichia coli strain PNUSAE008406 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | A0A891SNC1 |
Locus tag | N5921_RS09285 | Protein ID | WP_000342448.1 |
Coordinates | 1796471..1796998 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4NNI1 |
Locus tag | N5921_RS09290 | Protein ID | WP_001277108.1 |
Coordinates | 1797005..1797271 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5921_RS09260 (1791546) | 1791546..1792313 | - | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
N5921_RS09265 (1792310) | 1792310..1793587 | - | 1278 | WP_000803797.1 | branched chain amino acid ABC transporter permease LivM | - |
N5921_RS09270 (1793584) | 1793584..1794510 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
N5921_RS09275 (1794558) | 1794558..1795667 | - | 1110 | WP_001301528.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
N5921_RS09280 (1796091) | 1796091..1796474 | + | 384 | WP_000778769.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
N5921_RS09285 (1796471) | 1796471..1796998 | - | 528 | WP_000342448.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
N5921_RS09290 (1797005) | 1797005..1797271 | - | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
N5921_RS09295 (1797421) | 1797421..1798524 | - | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
N5921_RS09300 (1798795) | 1798795..1799649 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
N5921_RS09305 (1799894) | 1799894..1800952 | - | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
N5921_RS09310 (1800945) | 1800945..1801613 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19692.68 Da Isoelectric Point: 7.3232
>T258817 WP_000342448.1 NZ_CP104647:c1796998-1796471 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYKSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|