Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 1747616..1748370 | Replicon | chromosome |
Accession | NZ_CP104647 | ||
Organism | Escherichia coli strain PNUSAE008406 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | N5921_RS09075 | Protein ID | WP_001301452.1 |
Coordinates | 1747885..1748370 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | Q8X700 |
Locus tag | N5921_RS09070 | Protein ID | WP_000801912.1 |
Coordinates | 1747616..1747894 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5921_RS09065 (1744844) | 1744844..1747549 | + | 2706 | WP_000906970.1 | HTH-type transcriptional regulator MalT | - |
N5921_RS09070 (1747616) | 1747616..1747894 | + | 279 | WP_000801912.1 | DUF1778 domain-containing protein | Antitoxin |
N5921_RS09075 (1747885) | 1747885..1748370 | + | 486 | WP_001301452.1 | GNAT family N-acetyltransferase | Toxin |
N5921_RS09080 (1748420) | 1748420..1749448 | - | 1029 | WP_000827117.1 | RNA 3'-terminal phosphate cyclase | - |
N5921_RS09085 (1749452) | 1749452..1750678 | - | 1227 | WP_001105473.1 | RNA-splicing ligase RtcB | - |
N5921_RS09090 (1750866) | 1750866..1752464 | + | 1599 | WP_001232889.1 | DNA-binding transcriptional regulator RtcR | - |
N5921_RS09095 (1752446) | 1752446..1753204 | - | 759 | WP_001302007.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17650.57 Da Isoelectric Point: 9.4066
>T258816 WP_001301452.1 NZ_CP104647:1747885-1748370 [Escherichia coli]
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|