Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1112810..1113393 | Replicon | chromosome |
Accession | NZ_CP104647 | ||
Organism | Escherichia coli strain PNUSAE008406 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | N5921_RS05880 | Protein ID | WP_000254738.1 |
Coordinates | 1112810..1113145 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | N5921_RS05885 | Protein ID | WP_000581937.1 |
Coordinates | 1113145..1113393 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5921_RS05865 (1108697) | 1108697..1109995 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
N5921_RS05870 (1110083) | 1110083..1111720 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
N5921_RS05875 (1111948) | 1111948..1112739 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
N5921_RS05880 (1112810) | 1112810..1113145 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
N5921_RS05885 (1113145) | 1113145..1113393 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
N5921_RS05890 (1113471) | 1113471..1115705 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
N5921_RS05895 (1115753) | 1115753..1117054 | - | 1302 | WP_000046824.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T258812 WP_000254738.1 NZ_CP104647:c1113145-1112810 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|