Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 5311..5870 Replicon plasmid unnamed1
Accession NZ_CP104646
Organism Escherichia coli strain PNUSAE019785

Toxin (Protein)


Gene name relE Uniprot ID O82928
Locus tag N5932_RS27520 Protein ID WP_000421248.1
Coordinates 5595..5870 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID C1J8K5
Locus tag N5932_RS27515 Protein ID WP_001178089.1
Coordinates 5311..5595 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5932_RS27475 (508) 508..1068 + 561 WP_000840472.1 fertility inhibition protein FinO -
N5932_RS27480 (1201) 1201..1413 + 213 WP_001302189.1 ANR family transcriptional regulator -
N5932_RS27485 (1658) 1658..2119 + 462 WP_001233856.1 thermonuclease family protein -
N5932_RS27490 (2165) 2165..2374 + 210 WP_001302200.1 hemolysin expression modulator Hha -
N5932_RS27495 (2412) 2412..2750 + 339 WP_000766796.1 hypothetical protein -
N5932_RS27500 (2990) 2990..3244 + 255 WP_000083831.1 replication regulatory protein RepA -
N5932_RS27505 (3480) 3480..3554 + 75 WP_001370046.1 RepA leader peptide Tap -
N5932_RS27510 (3547) 3547..4404 + 858 WP_000130945.1 incFII family plasmid replication initiator RepA -
N5932_RS27515 (5311) 5311..5595 + 285 WP_001178089.1 ribbon-helix-helix domain-containing protein Antitoxin
N5932_RS27520 (5595) 5595..5870 + 276 WP_000421248.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5932_RS27525 (5965) 5965..6171 + 207 WP_001105064.1 hypothetical protein -
N5932_RS27530 (6271) 6271..6486 - 216 Protein_12 transposase -
N5932_RS27535 (6530) 6530..7096 - 567 Protein_13 IS3-like element IS600 family transposase -
N5932_RS27540 (7096) 7096..7512 - 417 Protein_14 IS91 family transposase -
N5932_RS27545 (7512) 7512..7697 - 186 WP_001302179.1 hypothetical protein -
N5932_RS27550 (7874) 7874..10084 + 2211 WP_261577671.1 catalase/peroxidase KatP -
N5932_RS27555 (10128) 10128..10517 + 390 WP_001172748.1 cytochrome b562 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - espP / stcE / exeE / exeG / hlyC / hlyA / hlyB / hlyD / toxB / toxB / toxB / toxB 1..91480 91480


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10735.42 Da        Isoelectric Point: 9.9324

>T258810 WP_000421248.1 NZ_CP104646:5595-5870 [Escherichia coli]
MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10474.89 Da        Isoelectric Point: 5.6558

>AT258810 WP_001178089.1 NZ_CP104646:5311-5595 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z6FAZ0

Antitoxin

Source ID Structure
AlphaFold DB A0A731IHA8

References