Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 4825559..4826197 | Replicon | chromosome |
Accession | NZ_CP104645 | ||
Organism | Escherichia coli strain PNUSAE019785 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | N5932_RS23940 | Protein ID | WP_000813794.1 |
Coordinates | 4825559..4825735 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N5932_RS23945 | Protein ID | WP_001270286.1 |
Coordinates | 4825781..4826197 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5932_RS23920 (4821180) | 4821180..4822353 | - | 1174 | Protein_4658 | BenE family transporter YdcO | - |
N5932_RS23925 (4822445) | 4822445..4822981 | + | 537 | WP_000429145.1 | DNA-binding transcriptional regulator SutR | - |
N5932_RS23930 (4823054) | 4823054..4825015 | + | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
N5932_RS23935 (4825107) | 4825107..4825337 | - | 231 | WP_000494244.1 | YncJ family protein | - |
N5932_RS23940 (4825559) | 4825559..4825735 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
N5932_RS23945 (4825781) | 4825781..4826197 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
N5932_RS23950 (4826276) | 4826276..4827682 | + | 1407 | WP_000760654.1 | PLP-dependent aminotransferase family protein | - |
N5932_RS23955 (4827927) | 4827927..4829072 | + | 1146 | WP_000047432.1 | ABC transporter substrate-binding protein | - |
N5932_RS23960 (4829090) | 4829090..4830103 | + | 1014 | WP_000220402.1 | ABC transporter ATP-binding protein | - |
N5932_RS23965 (4830104) | 4830104..4831045 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T258803 WP_000813794.1 NZ_CP104645:4825559-4825735 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT258803 WP_001270286.1 NZ_CP104645:4825781-4826197 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|