Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4330462..4331257 Replicon chromosome
Accession NZ_CP104645
Organism Escherichia coli strain PNUSAE019785

Toxin (Protein)


Gene name yeeV Uniprot ID B7UP43
Locus tag N5932_RS21155 Protein ID WP_000854914.1
Coordinates 4330883..4331257 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0B0VS41
Locus tag N5932_RS21150 Protein ID WP_001280954.1
Coordinates 4330462..4330836 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5932_RS21120 (4325817) 4325817..4326722 + 906 WP_000203541.1 diguanylate cyclase regulator RdcB family protein -
N5932_RS21125 (4326719) 4326719..4327789 + 1071 WP_000102669.1 patatin-like phospholipase family protein -
N5932_RS21130 (4328129) 4328129..4328947 + 819 WP_001234682.1 DUF932 domain-containing protein -
N5932_RS21135 (4329038) 4329038..4329523 + 486 WP_000214398.1 antirestriction protein -
N5932_RS21140 (4329539) 4329539..4330015 + 477 WP_001186738.1 RadC family protein -
N5932_RS21145 (4330078) 4330078..4330299 + 222 WP_001220314.1 DUF987 domain-containing protein -
N5932_RS21150 (4330462) 4330462..4330836 + 375 WP_001280954.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N5932_RS21155 (4330883) 4330883..4331257 + 375 WP_000854914.1 TA system toxin CbtA family protein Toxin
N5932_RS21160 (4331254) 4331254..4331745 + 492 WP_000976853.1 DUF5983 family protein -
N5932_RS21165 (4331757) 4331757..4331954 + 198 WP_000839282.1 DUF957 domain-containing protein -
N5932_RS21170 (4332039) 4332039..4332881 + 843 WP_001280481.1 DUF4942 domain-containing protein -
N5932_RS21180 (4333352) 4333352..4334290 + 939 WP_000351284.1 glyoxylate/hydroxypyruvate reductase GhrA -
N5932_RS21185 (4334345) 4334345..4335082 + 738 WP_000283664.1 zinc-binding phosphatase -
N5932_RS21190 (4335106) 4335106..4335660 + 555 WP_001001917.1 molecular chaperone YcdY -
N5932_RS21195 (4335762) 4335762..4336253 + 492 WP_001301587.1 DUF1097 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - iroB / csgG / csgF / csgE / csgD / csgB / csgA / csgC 4299732..4341821 42089


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14117.17 Da        Isoelectric Point: 7.7761

>T258801 WP_000854914.1 NZ_CP104645:4330883-4331257 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13718.51 Da        Isoelectric Point: 6.6249

>AT258801 WP_001280954.1 NZ_CP104645:4330462-4330836 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LXR5

Antitoxin

Source ID Structure
AlphaFold DB A0A0B0VS41

References