Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 4104979..4105457 Replicon chromosome
Accession NZ_CP104645
Organism Escherichia coli strain PNUSAE019785

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A891SFN9
Locus tag N5932_RS19960 Protein ID WP_001303876.1
Coordinates 4104979..4105266 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID Q8XD67
Locus tag N5932_RS19965 Protein ID WP_000536233.1
Coordinates 4105266..4105457 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5932_RS19925 (4100126) 4100126..4102599 - 2474 Protein_3871 3'-5' exoribonuclease -
N5932_RS19930 (4102693) 4102693..4102884 - 192 WP_001098307.1 DUF1482 family protein -
N5932_RS19935 (4102881) 4102881..4103069 - 189 WP_000413705.1 cell division inhibition protein DicB -
N5932_RS19940 (4103643) 4103643..4103828 + 186 WP_001133046.1 hypothetical protein -
N5932_RS19945 (4104015) 4104015..4104404 - 390 WP_000394511.1 hypothetical protein -
N5932_RS19950 (4104416) 4104416..4104544 - 129 WP_000344963.1 protein YdfB -
N5932_RS19955 (4104546) 4104546..4104701 - 156 WP_000379575.1 DUF1391 family protein -
N5932_RS19960 (4104979) 4104979..4105266 - 288 WP_001303876.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N5932_RS19965 (4105266) 4105266..4105457 - 192 WP_000536233.1 hypothetical protein Antitoxin
N5932_RS19970 (4105485) 4105485..4105886 - 402 WP_000986592.1 helix-turn-helix domain-containing protein -
N5932_RS19975 (4105995) 4105995..4106267 + 273 WP_000887453.1 YdaS family helix-turn-helix protein -
N5932_RS19980 (4106251) 4106251..4106676 + 426 WP_000693855.1 toxin YdaT family protein -
N5932_RS19985 (4106883) 4106883..4107338 - 456 WP_000273724.1 hypothetical protein -
N5932_RS19990 (4107417) 4107417..4108514 + 1098 WP_001475117.1 hypothetical protein -
N5932_RS19995 (4108521) 4108521..4109267 + 747 WP_000788745.1 ATP-binding protein -
N5932_RS20000 (4109289) 4109289..4110059 + 771 WP_000450992.1 DUF1627 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10978.84 Da        Isoelectric Point: 10.1360

>T258799 WP_001303876.1 NZ_CP104645:c4105266-4104979 [Escherichia coli]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7025.80 Da        Isoelectric Point: 4.0270

>AT258799 WP_000536233.1 NZ_CP104645:c4105457-4105266 [Escherichia coli]
MGTALSPIVSEFETTEQENSYNEWLRTKVTSSLADTRPAIPHDEVMAEMENLIAQIAVTNKSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References