Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/- |
| Location | 4104979..4105457 | Replicon | chromosome |
| Accession | NZ_CP104645 | ||
| Organism | Escherichia coli strain PNUSAE019785 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | A0A891SFN9 |
| Locus tag | N5932_RS19960 | Protein ID | WP_001303876.1 |
| Coordinates | 4104979..4105266 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | Q8XD67 |
| Locus tag | N5932_RS19965 | Protein ID | WP_000536233.1 |
| Coordinates | 4105266..4105457 (-) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5932_RS19925 (4100126) | 4100126..4102599 | - | 2474 | Protein_3871 | 3'-5' exoribonuclease | - |
| N5932_RS19930 (4102693) | 4102693..4102884 | - | 192 | WP_001098307.1 | DUF1482 family protein | - |
| N5932_RS19935 (4102881) | 4102881..4103069 | - | 189 | WP_000413705.1 | cell division inhibition protein DicB | - |
| N5932_RS19940 (4103643) | 4103643..4103828 | + | 186 | WP_001133046.1 | hypothetical protein | - |
| N5932_RS19945 (4104015) | 4104015..4104404 | - | 390 | WP_000394511.1 | hypothetical protein | - |
| N5932_RS19950 (4104416) | 4104416..4104544 | - | 129 | WP_000344963.1 | protein YdfB | - |
| N5932_RS19955 (4104546) | 4104546..4104701 | - | 156 | WP_000379575.1 | DUF1391 family protein | - |
| N5932_RS19960 (4104979) | 4104979..4105266 | - | 288 | WP_001303876.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5932_RS19965 (4105266) | 4105266..4105457 | - | 192 | WP_000536233.1 | hypothetical protein | Antitoxin |
| N5932_RS19970 (4105485) | 4105485..4105886 | - | 402 | WP_000986592.1 | helix-turn-helix domain-containing protein | - |
| N5932_RS19975 (4105995) | 4105995..4106267 | + | 273 | WP_000887453.1 | YdaS family helix-turn-helix protein | - |
| N5932_RS19980 (4106251) | 4106251..4106676 | + | 426 | WP_000693855.1 | toxin YdaT family protein | - |
| N5932_RS19985 (4106883) | 4106883..4107338 | - | 456 | WP_000273724.1 | hypothetical protein | - |
| N5932_RS19990 (4107417) | 4107417..4108514 | + | 1098 | WP_001475117.1 | hypothetical protein | - |
| N5932_RS19995 (4108521) | 4108521..4109267 | + | 747 | WP_000788745.1 | ATP-binding protein | - |
| N5932_RS20000 (4109289) | 4109289..4110059 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10978.84 Da Isoelectric Point: 10.1360
>T258799 WP_001303876.1 NZ_CP104645:c4105266-4104979 [Escherichia coli]
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI
MLPILWLPSARDDLRQIITYIAKENPPAARRLKIRIETSVLPLSEHPYLYPPSERVSGLREIVTHPNYIILYRVAASSIE
IVSVTHSRRQFPFSI
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|