Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 2739631..2740226 | Replicon | chromosome |
Accession | NZ_CP104645 | ||
Organism | Escherichia coli strain PNUSAE019785 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | N5932_RS13755 | Protein ID | WP_000239579.1 |
Coordinates | 2739876..2740226 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | Q8XCF3 |
Locus tag | N5932_RS13750 | Protein ID | WP_001223210.1 |
Coordinates | 2739631..2739882 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5932_RS13740 (2735296) | 2735296..2739075 | + | 3780 | WP_000060930.1 | autotransporter assembly complex protein TamB | - |
N5932_RS13745 (2739078) | 2739078..2739419 | + | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
N5932_RS13750 (2739631) | 2739631..2739882 | + | 252 | WP_001223210.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
N5932_RS13755 (2739876) | 2739876..2740226 | + | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
N5932_RS13760 (2740306) | 2740306..2740836 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
N5932_RS13765 (2741146) | 2741146..2742102 | + | 957 | WP_000265942.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
N5932_RS13770 (2742242) | 2742242..2743744 | + | 1503 | Protein_2666 | sugar ABC transporter ATP-binding protein | - |
N5932_RS13775 (2743758) | 2743758..2744780 | + | 1023 | WP_001301928.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T258790 WP_000239579.1 NZ_CP104645:2739876-2740226 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|