Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 1731549..1732303 | Replicon | chromosome |
| Accession | NZ_CP104645 | ||
| Organism | Escherichia coli strain PNUSAE019785 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | N5932_RS08970 | Protein ID | WP_001301452.1 |
| Coordinates | 1731818..1732303 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | Q8X700 |
| Locus tag | N5932_RS08965 | Protein ID | WP_000801912.1 |
| Coordinates | 1731549..1731827 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5932_RS08960 (1728777) | 1728777..1731482 | + | 2706 | WP_000906970.1 | HTH-type transcriptional regulator MalT | - |
| N5932_RS08965 (1731549) | 1731549..1731827 | + | 279 | WP_000801912.1 | DUF1778 domain-containing protein | Antitoxin |
| N5932_RS08970 (1731818) | 1731818..1732303 | + | 486 | WP_001301452.1 | GNAT family N-acetyltransferase | Toxin |
| N5932_RS08975 (1732353) | 1732353..1733381 | - | 1029 | WP_000827117.1 | RNA 3'-terminal phosphate cyclase | - |
| N5932_RS08980 (1733385) | 1733385..1734611 | - | 1227 | WP_001105473.1 | RNA-splicing ligase RtcB | - |
| N5932_RS08985 (1734799) | 1734799..1736397 | + | 1599 | WP_001232889.1 | DNA-binding transcriptional regulator RtcR | - |
| N5932_RS08990 (1736379) | 1736379..1737137 | - | 759 | WP_001302007.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17650.57 Da Isoelectric Point: 9.4066
>T258784 WP_001301452.1 NZ_CP104645:1731818-1732303 [Escherichia coli]
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
MGITAPTPLTSEHNLADFCCSDHGMNEWLKKKALKNHSSGLSRVYVICIANTRQVIGYYCLSTGSIQRNLAPGAMRRNAP
ESLPVVVLGRLAIDQAWAGKGLGVALLKDAVYRTMSIAQQVGVRALIVHALDDSVRNFYLKYAFVPSPFQSLTLLYPITL
E
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|