Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1243467..1244121 | Replicon | chromosome |
| Accession | NZ_CP104645 | ||
| Organism | Escherichia coli strain PNUSAE019785 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | N5932_RS06455 | Protein ID | WP_000244781.1 |
| Coordinates | 1243467..1243874 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N5932_RS06460 | Protein ID | WP_000354046.1 |
| Coordinates | 1243855..1244121 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5932_RS06435 (1239424) | 1239424..1241157 | - | 1734 | WP_000813185.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| N5932_RS06440 (1241163) | 1241163..1241873 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N5932_RS06445 (1241898) | 1241898..1242794 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| N5932_RS06450 (1242906) | 1242906..1243427 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N5932_RS06455 (1243467) | 1243467..1243874 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| N5932_RS06460 (1243855) | 1243855..1244121 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N5932_RS06465 (1244364) | 1244364..1245344 | + | 981 | WP_000886053.1 | tRNA-modifying protein YgfZ | - |
| N5932_RS06470 (1245421) | 1245421..1246080 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| N5932_RS06475 (1246244) | 1246244..1246555 | - | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| N5932_RS06480 (1246600) | 1246600..1248033 | + | 1434 | WP_001310226.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T258781 WP_000244781.1 NZ_CP104645:c1243874-1243467 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|