Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 29139..29664 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104644 | ||
| Organism | Salmonella enterica strain 1020677 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | I3W3D5 |
| Locus tag | N5930_RS23180 | Protein ID | WP_001159863.1 |
| Coordinates | 29139..29444 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7S5D0 |
| Locus tag | N5930_RS23185 | Protein ID | WP_000813641.1 |
| Coordinates | 29446..29664 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5930_RS23140 (N5930_23145) | 24518..25078 | - | 561 | WP_000900095.1 | inverse autotransporter beta domain-containing protein | - |
| N5930_RS23145 (N5930_23150) | 25234..25521 | + | 288 | WP_071530243.1 | hypothetical protein | - |
| N5930_RS23150 (N5930_23155) | 25798..26283 | - | 486 | WP_000905606.1 | membrane protein | - |
| N5930_RS23155 (N5930_23160) | 26277..26765 | - | 489 | WP_001075507.1 | CaiF/GrlA family transcriptional regulator | - |
| N5930_RS23160 (N5930_23165) | 26790..27503 | - | 714 | WP_000545756.1 | EAL domain-containing protein | - |
| N5930_RS23165 (N5930_23170) | 27512..28294 | - | 783 | WP_000082169.1 | site-specific integrase | - |
| N5930_RS23170 (N5930_23175) | 28329..28850 | - | 522 | WP_000198608.1 | hypothetical protein | - |
| N5930_RS23175 (N5930_23180) | 28847..29137 | - | 291 | WP_001266176.1 | hypothetical protein | - |
| N5930_RS23180 (N5930_23185) | 29139..29444 | - | 306 | WP_001159863.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| N5930_RS23185 (N5930_23190) | 29446..29664 | - | 219 | WP_000813641.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| N5930_RS23190 (N5930_23195) | 30340..30861 | + | 522 | WP_077681952.1 | hypothetical protein | - |
| N5930_RS23195 (N5930_23200) | 30905..31333 | - | 429 | Protein_36 | hypothetical protein | - |
| N5930_RS23200 (N5930_23205) | 31345..31640 | + | 296 | Protein_37 | cytoplasmic protein | - |
| N5930_RS23205 (N5930_23210) | 32134..33123 | + | 990 | WP_000461382.1 | RepB family plasmid replication initiator protein | - |
| N5930_RS23210 (N5930_23215) | 33454..33573 | - | 120 | Protein_39 | recombinase | - |
| N5930_RS23215 (N5930_23220) | 33626..34012 | - | 387 | WP_000751876.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | spvB / spvC / fdeC / pefB / pefA / pefC / pefD / rck | 1..59329 | 59329 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11587.48 Da Isoelectric Point: 6.9787
>T258779 WP_001159863.1 NZ_CP104644:c29444-29139 [Salmonella enterica]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | I3W3D5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656ICA6 |