258779

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 29139..29664 Replicon plasmid unnamed1
Accession NZ_CP104644
Organism Salmonella enterica strain 1020677

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag N5930_RS23180 Protein ID WP_001159863.1
Coordinates 29139..29444 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag N5930_RS23185 Protein ID WP_000813641.1
Coordinates 29446..29664 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5930_RS23140 (N5930_23145) 24518..25078 - 561 WP_000900095.1 inverse autotransporter beta domain-containing protein -
N5930_RS23145 (N5930_23150) 25234..25521 + 288 WP_071530243.1 hypothetical protein -
N5930_RS23150 (N5930_23155) 25798..26283 - 486 WP_000905606.1 membrane protein -
N5930_RS23155 (N5930_23160) 26277..26765 - 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
N5930_RS23160 (N5930_23165) 26790..27503 - 714 WP_000545756.1 EAL domain-containing protein -
N5930_RS23165 (N5930_23170) 27512..28294 - 783 WP_000082169.1 site-specific integrase -
N5930_RS23170 (N5930_23175) 28329..28850 - 522 WP_000198608.1 hypothetical protein -
N5930_RS23175 (N5930_23180) 28847..29137 - 291 WP_001266176.1 hypothetical protein -
N5930_RS23180 (N5930_23185) 29139..29444 - 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
N5930_RS23185 (N5930_23190) 29446..29664 - 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
N5930_RS23190 (N5930_23195) 30340..30861 + 522 WP_077681952.1 hypothetical protein -
N5930_RS23195 (N5930_23200) 30905..31333 - 429 Protein_36 hypothetical protein -
N5930_RS23200 (N5930_23205) 31345..31640 + 296 Protein_37 cytoplasmic protein -
N5930_RS23205 (N5930_23210) 32134..33123 + 990 WP_000461382.1 RepB family plasmid replication initiator protein -
N5930_RS23210 (N5930_23215) 33454..33573 - 120 Protein_39 recombinase -
N5930_RS23215 (N5930_23220) 33626..34012 - 387 WP_000751876.1 YgiW/YdeI family stress tolerance OB fold protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - spvB / spvC / fdeC / pefB / pefA / pefC / pefD / rck 1..59329 59329


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T258779 WP_001159863.1 NZ_CP104644:c29444-29139 [Salmonella enterica]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT258779 WP_000813641.1 NZ_CP104644:c29664-29446 [Salmonella enterica]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References