Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4570582..4571363 | Replicon | chromosome |
Accession | NZ_CP104643 | ||
Organism | Salmonella enterica strain 1020677 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B5R980 |
Locus tag | N5930_RS22410 | Protein ID | WP_000626100.1 |
Coordinates | 4570582..4571073 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | N5930_RS22415 | Protein ID | WP_001110452.1 |
Coordinates | 4571070..4571363 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5930_RS22375 (4566042) | 4566042..4566389 | + | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
N5930_RS22380 (4566365) | 4566365..4568068 | + | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
N5930_RS22385 (4568105) | 4568105..4568680 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
N5930_RS22395 (4568951) | 4568951..4569025 | - | 75 | Protein_4356 | helix-turn-helix domain-containing protein | - |
N5930_RS22400 (4569405) | 4569405..4569482 | + | 78 | Protein_4357 | porin family protein | - |
N5930_RS22405 (4569582) | 4569582..4570334 | + | 753 | WP_000842433.1 | non-specific acid phosphatase | - |
N5930_RS22410 (4570582) | 4570582..4571073 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
N5930_RS22415 (4571070) | 4571070..4571363 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
N5930_RS22420 (4571680) | 4571680..4571901 | + | 222 | WP_001576552.1 | hypothetical protein | - |
N5930_RS22425 (4572167) | 4572167..4573042 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
N5930_RS22430 (4573039) | 4573039..4573326 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
N5930_RS22435 (4573319) | 4573319..4573627 | - | 309 | WP_072095651.1 | ABC transporter ATP-binding protein | - |
N5930_RS22440 (4573626) | 4573626..4573874 | + | 249 | Protein_4365 | Ig-like domain-containing protein | - |
N5930_RS22445 (4573986) | 4573986..4574117 | + | 132 | Protein_4366 | hypothetical protein | - |
N5930_RS22450 (4574411) | 4574411..4575316 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T258778 WP_000626100.1 NZ_CP104643:c4571073-4570582 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656IQ80 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1DGA4 |