Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4463686..4464202 | Replicon | chromosome |
Accession | NZ_CP104643 | ||
Organism | Salmonella enterica strain 1020677 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B5R9I9 |
Locus tag | N5930_RS21835 | Protein ID | WP_000220582.1 |
Coordinates | 4463686..4463970 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | N5930_RS21840 | Protein ID | WP_000212724.1 |
Coordinates | 4463960..4464202 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5930_RS21820 (4458897) | 4458897..4460549 | + | 1653 | WP_000155048.1 | alpha,alpha-phosphotrehalase | - |
N5930_RS21825 (4460958) | 4460958..4463096 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N5930_RS21830 (4463218) | 4463218..4463682 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N5930_RS21835 (4463686) | 4463686..4463970 | - | 285 | WP_000220582.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5930_RS21840 (4463960) | 4463960..4464202 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N5930_RS21845 (4464280) | 4464280..4466193 | - | 1914 | WP_001212142.1 | BglG family transcription antiterminator | - |
N5930_RS21850 (4466210) | 4466210..4466950 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
N5930_RS21855 (4466947) | 4466947..4468065 | - | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
N5930_RS21860 (4468049) | 4468049..4469182 | - | 1134 | WP_000459957.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.66 Da Isoelectric Point: 9.6743
>T258777 WP_000220582.1 NZ_CP104643:c4463970-4463686 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656ILJ8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |