Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4422561..4423111 | Replicon | chromosome |
| Accession | NZ_CP104643 | ||
| Organism | Salmonella enterica strain 1020677 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | N5930_RS21625 | Protein ID | WP_001199743.1 |
| Coordinates | 4422561..4422869 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7RP97 |
| Locus tag | N5930_RS21630 | Protein ID | WP_001118105.1 |
| Coordinates | 4422872..4423111 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5930_RS21605 (4419135) | 4419135..4419875 | - | 741 | WP_001676217.1 | SEF14/SEF18 fimbria chaperone SefB | - |
| N5930_RS21610 (4419997) | 4419997..4420527 | - | 531 | WP_001708209.1 | SEF14 fimbria major subunit SefA | - |
| N5930_RS21615 (4420850) | 4420850..4421983 | + | 1134 | Protein_4205 | IS3 family transposase | - |
| N5930_RS21620 (4422015) | 4422015..4422155 | - | 141 | Protein_4206 | Arm DNA-binding domain-containing protein | - |
| N5930_RS21625 (4422561) | 4422561..4422869 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| N5930_RS21630 (4422872) | 4422872..4423111 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| N5930_RS21635 (4423220) | 4423220..4423468 | - | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
| N5930_RS21640 (4423545) | 4423545..4424090 | - | 546 | WP_223151225.1 | helix-turn-helix domain-containing protein | - |
| N5930_RS21650 (4424847) | 4424847..4425866 | + | 1020 | WP_000152558.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| N5930_RS21655 (4425894) | 4425894..4426424 | - | 531 | WP_000896758.1 | gluconokinase | - |
| N5930_RS21660 (4426641) | 4426641..4427672 | + | 1032 | WP_000453347.1 | L-idonate 5-dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 4420942..4424045 | 3103 | |
| - | inside | Genomic island | - | - | 4403818..4423468 | 19650 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T258776 WP_001199743.1 NZ_CP104643:c4422869-4422561 [Salmonella enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H9SZK8 |