Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4372286..4372862 | Replicon | chromosome |
| Accession | NZ_CP104643 | ||
| Organism | Salmonella enterica strain 1020677 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | M7RG88 |
| Locus tag | N5930_RS21390 | Protein ID | WP_001131963.1 |
| Coordinates | 4372575..4372862 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | B5R9R5 |
| Locus tag | N5930_RS21385 | Protein ID | WP_000063142.1 |
| Coordinates | 4372286..4372588 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5930_RS21370 (4368796) | 4368796..4370946 | + | 2151 | WP_000379928.1 | pyruvate/proton symporter BtsT | - |
| N5930_RS21375 (4371041) | 4371041..4371244 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
| N5930_RS21380 (4371255) | 4371255..4372211 | + | 957 | WP_000187843.1 | GTPase | - |
| N5930_RS21385 (4372286) | 4372286..4372588 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
| N5930_RS21390 (4372575) | 4372575..4372862 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
| N5930_RS21395 (4373293) | 4373293..4375134 | + | 1842 | WP_000974637.1 | nuclease-related domain-containing DEAD/DEAH box helicase | - |
| N5930_RS21400 (4375747) | 4375747..4376322 | + | 576 | WP_000593784.1 | restriction endonuclease subunit S | - |
| N5930_RS21405 (4376327) | 4376327..4377580 | + | 1254 | WP_001206755.1 | N-6 DNA methylase | - |
| N5930_RS21410 (4377612) | 4377612..4377746 | - | 135 | WP_001055725.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T258775 WP_001131963.1 NZ_CP104643:c4372862-4372575 [Salmonella enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7VD7 | |
| AlphaFold DB | A0A4D6PB01 |